Description
Cathelicidin LL 37 is a human cathelicidin peptide that forms part of innate host-defense signaling. The LL-37 antimicrobial peptide is used in laboratory models to examine bacterial membrane interactions, immune cell recruitment, cytokine activity, epithelial responses, and host defense mechanisms. Its cationic amphipathic structure also makes it relevant to experiments investigating how antimicrobial peptides interact with microbial membranes and surrounding cellular environments.
Antimicrobial peptide research involving LL-37 extends beyond direct microbial activity into chemotaxis, inflammatory regulation, epithelial signaling, and tissue-response pathways. These characteristics position the peptide for controlled investigation of innate immunity and peptide-mediated host-defense responses across diverse experimental systems.
Features
- Classification: Human cathelicidin antimicrobial peptide
- Structure: 37-amino-acid peptide
- Sequence: [LL-37, 37 aa]
- Molecular Formula: C205H340N60O53
- Molecular Weight: Approximately 4,493 g/mol
Disclaimer: Supplied strictly for laboratory research. Not intended for human or veterinary administration, consumption, diagnosis, treatment, or therapeutic use.
Reviews
There are no reviews yet.